Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR84 Rabbit Polyclonal Antibody (Biotin)

GPR84 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EX33, GPCR4

UniProt

Q9NQS5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR84

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_065103

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human POLD4 shRNA (UAS) - Lentiviral human POLD4 shRNA (UAS) (100)
GTR15112338 1 Vial

Lentiviral human POLD4 shRNA (UAS) - Lentiviral human POLD4 shRNA (UAS) (100)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 4/CCL18 Rabbit Polyclonal Antibody (HRP)
orb2574091 100 µg

Macrophage Inflammatory Protein 4/CCL18 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PCMV-TFAM-Myc-Neo Plasmid
PVT64426 2 µg

PCMV-TFAM-Myc-Neo Plasmid

Sign In for Pricing
View Details
Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (PE)
MBS6395498-01 0.1 mL

Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (PE)

Sign In for Pricing
View Details
Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (PE)
MBS6395498-02 5x 0.1 mL

Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (PE)

Sign In for Pricing
View Details
Porcine mid regional pro adrenomedullin MR (ProADM) ELISA Kit
MBS2600200-01 48 Well

Porcine mid regional pro adrenomedullin MR (ProADM) ELISA Kit

Sign In for Pricing
View Details