Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK3 Rabbit Polyclonal Antibody (FITC)

HOOK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HK3

UniProt

Q86VS8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOOK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT5 (ADP-sugar Pyrophosphatase, 8-oxo-dGDP Phosphatase, Nucleoside Diphosphate-linked Moiety X Motif 5, Nudix Motif 5, YSA1H, HSPC115) (MaxLight 405) discontinued
130636-ML405 100 µL

NUDT5 (ADP-sugar Pyrophosphatase, 8-oxo-dGDP Phosphatase, Nucleoside Diphosphate-linked Moiety X Motif 5, Nudix Motif 5, YSA1H, HSPC115) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)
MBS1078647-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)
MBS1078647-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)
MBS1078647-03 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)
MBS1078647-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)
MBS1078647-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O1:K1 / APEC Ribonuclease HII (rnhB)

Sign In for Pricing
View Details