Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Rabbit Polyclonal Antibody (Biotin)

MOB1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MOB1, MATS1, Mob4B, C2orf6, MOBK1B, MOBKL1B

UniProt

Q9H8S9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MOB1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT5 antibody - N-terminal region (ARP54825_P050)
ARP54825_P050 100 µL

CCT5 antibody - N-terminal region (ARP54825_P050)

Sign In for Pricing
View Details
NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (MaxLight 490)
MBS6327123-01 0.1 mL

NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (MaxLight 490)

Sign In for Pricing
View Details
NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (MaxLight 490)
MBS6327123-02 5x 0.1 mL

NUDT15, CT (NUDT15, MTH2, Probable 8-oxo-dGTP diphosphatase NUDT15, 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15) (MaxLight 490)

Sign In for Pricing
View Details
Procalcitonin Rat Recombinant Protein
PROTP01257-01 2 µg

Procalcitonin Rat Recombinant Protein

Sign In for Pricing
View Details
Procalcitonin Rat Recombinant Protein
PROTP01257-02 1 mg

Procalcitonin Rat Recombinant Protein

Sign In for Pricing
View Details
RAB6D (NM_001077637) Human Over-expression Lysate
LS150786 100 µg

RAB6D (NM_001077637) Human Over-expression Lysate

Sign In for Pricing
View Details