Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Rabbit Polyclonal Antibody (FITC)

MOB1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MOB1, MATS1, Mob4B, C2orf6, MOBK1B, MOBKL1B

UniProt

Q9H8S9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MOB1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MLLT1 shRNA (UAS) - Lentiviral human MLLT1 shRNA (UAS, iRFP) plasmid
GTR15093076 1 Vial

Lentiviral human MLLT1 shRNA (UAS) - Lentiviral human MLLT1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-FBG5 Antibody
orb1148842 100 µg

Anti-FBG5 Antibody

Sign In for Pricing
View Details
Anti-RBM5 Antibody Picoband® Fluoro594 Conjugated
A03559-2-Fluoro594 100 µg/Vial

Anti-RBM5 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Recombinant Human ADP-ribosyl cyclase 2 (BST1)
MBS1327667-01 0.02 mg (E-Coli)

Recombinant Human ADP-ribosyl cyclase 2 (BST1)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosyl cyclase 2 (BST1)
MBS1327667-02 0.02 mg (Yeast)

Recombinant Human ADP-ribosyl cyclase 2 (BST1)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosyl cyclase 2 (BST1)
MBS1327667-03 0.1 mg (E-Coli)

Recombinant Human ADP-ribosyl cyclase 2 (BST1)

Sign In for Pricing
View Details