Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PISD Rabbit Polyclonal Antibody (FITC)

PISD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSD, LIBF, PSDC, PSSC, DJ858B16, dJ858B16.2

UniProt

Q9UG56

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PISD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Adenylate cyclase type 5 (ADCY5) ELISA kit
GTR10475928 96 Well

Monkey Adenylate cyclase type 5 (ADCY5) ELISA kit

Sign In for Pricing
View Details
GRIN2D (Glutamate Receptor Ionotropic, NMDA 2D, GluN2D, EB11, Glutamate [NMDA] Receptor Subunit Epsilon-4, N-methyl D-aspartate Receptor Subtype 2D, NMDAR2D, NR2D, GRIN2D, GluN2D, NMDAR2D)
406524-01 50 µL

GRIN2D (Glutamate Receptor Ionotropic, NMDA 2D, GluN2D, EB11, Glutamate [NMDA] Receptor Subunit Epsilon-4, N-methyl D-aspartate Receptor Subtype 2D, NMDAR2D, NR2D, GRIN2D, GluN2D, NMDAR2D)

Sign In for Pricing
View Details
GRIN2D (Glutamate Receptor Ionotropic, NMDA 2D, GluN2D, EB11, Glutamate [NMDA] Receptor Subunit Epsilon-4, N-methyl D-aspartate Receptor Subtype 2D, NMDAR2D, NR2D, GRIN2D, GluN2D, NMDAR2D)
406524-02 100 µL

GRIN2D (Glutamate Receptor Ionotropic, NMDA 2D, GluN2D, EB11, Glutamate [NMDA] Receptor Subunit Epsilon-4, N-methyl D-aspartate Receptor Subtype 2D, NMDAR2D, NR2D, GRIN2D, GluN2D, NMDAR2D)

Sign In for Pricing
View Details
Human Pyruvate kinase isozymes R; L (PKLR) ELISA Kit
YP-W15312-01 48 Tests

Human Pyruvate kinase isozymes R; L (PKLR) ELISA Kit

Sign In for Pricing
View Details
Human Pyruvate kinase isozymes R; L (PKLR) ELISA Kit
YP-W15312-02 96 Tests

Human Pyruvate kinase isozymes R; L (PKLR) ELISA Kit

Sign In for Pricing
View Details
Ohaus Valor V22XWE3T stainless steel Balance 3kg x 0.5g
30072349 1 Each

Ohaus Valor V22XWE3T stainless steel Balance 3kg x 0.5g

Sign In for Pricing
View Details