Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD6 Rabbit Polyclonal Antibody (HRP)

STARD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P59095

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STARD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_631910

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) ELISA Kit
RD-CEACAM7-Hu-01 96 Tests

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) ELISA Kit

Sign In for Pricing
View Details
Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) ELISA Kit
RD-CEACAM7-Hu-02 48 Tests

Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS647840 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details