Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS1R1 Rabbit Polyclonal Antibody (HRP)

TAS1R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TR1, T1R1, GM148, GPR70

UniProt

Q7RTX1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS1R1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1639 (NM_001000833) Rat Untagged Clone
RN210827 10 µg

Olr1639 (NM_001000833) Rat Untagged Clone

Sign In for Pricing
View Details
DUSP6 ORF Vector (Human) (pORF)
ORF003326 1.0 µg DNA

DUSP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Buffer PL1 (1000 mL)
MN 740918.1 1000 mL

Buffer PL1 (1000 mL)

Sign In for Pricing
View Details
CCNA2 Antibody
E30AC904 100 µL

CCNA2 Antibody

Sign In for Pricing
View Details
Recombinant Stigmatella aurantiaca Elongation factor Tu (tuf)
MBS1127581-01 0.02 mg (E-Coli)

Recombinant Stigmatella aurantiaca Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Stigmatella aurantiaca Elongation factor Tu (tuf)
MBS1127581-02 0.02 mg (Yeast)

Recombinant Stigmatella aurantiaca Elongation factor Tu (tuf)

Sign In for Pricing
View Details