Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTS14 Rabbit Polyclonal Antibody (HRP)

ADAMTS14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ32820

UniProt

Q5T4G1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTS14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REAVQQEWAEPDGDLHNEAFGLGDLPNLLGLVGDQLGDTERKRRHAKPGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_631894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN2, ID (DCTN2, DCTN50, Dynactin subunit 2, 50kD dynein-associated polypeptide, Dynactin complex 50kD subunit, p50 dynamitin) (APC) discontinued
034520-APC 200 µL

DCTN2, ID (DCTN2, DCTN50, Dynactin subunit 2, 50kD dynein-associated polypeptide, Dynactin complex 50kD subunit, p50 dynamitin) (APC) discontinued

Sign In for Pricing
View Details
01/09/2012 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2803108 1.0 µg DNA

01/09/2012 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Chromatin Assembly Factor 1, Subunit B (CHAF1B) Antibody
abx340034-01 100 µg

Chromatin Assembly Factor 1, Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Chromatin Assembly Factor 1, Subunit B (CHAF1B) Antibody
abx340034-02 1 mg

Chromatin Assembly Factor 1, Subunit B (CHAF1B) Antibody

Sign In for Pricing
View Details
Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [CoraFluor 1]
NBP3-27986CL1 0.1 mL

Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [CoraFluor 1]

Sign In for Pricing
View Details
1000ml, PETG, Flat Bottom, Plug Cap, sterile
EFG-1000P 6 PCS/Case

1000ml, PETG, Flat Bottom, Plug Cap, sterile

Sign In for Pricing
View Details