Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR1OP2 Rabbit Polyclonal Antibody (Biotin)

FGFR1OP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WIT3.0, HSPC123-like

UniProt

Q9NVK5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGFR1OP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amyloid beta (1-14) Rabbit Polyclonal Antibody
AP09220PU-N 100 µg

Amyloid beta (1-14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bak (BAK1) Mouse Monoclonal Antibody [Clone ID: AT8B4]
AM09369PU-N 100 µL

Bak (BAK1) Mouse Monoclonal Antibody [Clone ID: AT8B4]

Sign In for Pricing
View Details
SHISAL2B Human Gene Knockout Kit (CRISPR)
KN428094 1 Kit

SHISAL2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF640R conjugate, 0.1mg/mL
BNC401862-100 1x 100 µL

CD79a (B-Cell Marker) (rIGA/764), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]
TA801245AM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF568 conjugate, 0.1mg/mL
BNC682259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details