Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLOT1 Rabbit Polyclonal Antibody (HRP)

FLOT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O75955

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLOT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK7 Antibody
A15046-50UG 50 µg

PAK7 Antibody

Sign In for Pricing
View Details
Mouse Keratin, type II cytoskeletal 71 (KRT71) ELISA Kit
abx529262 96 Tests

Mouse Keratin, type II cytoskeletal 71 (KRT71) ELISA Kit

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)
MBS1232007-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)
MBS1232007-02 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)
MBS1232007-03 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)
MBS1232007-04 0.1 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details