Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5A Rabbit Polyclonal Antibody (Biotin)

KIR2DL5A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

UniProt

Q8N109

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_065396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOPSO sodium salt
GB3228-25g 25 g

MOPSO sodium salt

Sign In for Pricing
View Details
RNF213 Protein Lysate (Human) with C-Ha Tag
40290031 100 µg

RNF213 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CXCR4 Knockout AGS Polyclonal Cells
ARG2818 1 Million

CXCR4 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Nuak1 shRNA (UAS) - Lentiviral mouse Nuak1 shRNA (UAS, GFP) (100)
GTR15275505 1 Vial

Lentiviral mouse Nuak1 shRNA (UAS) - Lentiviral mouse Nuak1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)
MBS2146703-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)
MBS2146703-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL)

Sign In for Pricing
View Details