Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL12 Rabbit Polyclonal Antibody (FITC)

MRPL12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

5c5-2, L12mt, MRPL7, RPML12, MRPL7/L12, MRP-L31/34

UniProt

P52815

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MRPL12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_002940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMAD2 shRNA (UAS) - Lentiviral human SMAD2 shRNA (UAS, RFP) (100)
GTR15159264 1 Vial

Lentiviral human SMAD2 shRNA (UAS) - Lentiviral human SMAD2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
KCTD12, ID (KCTD12, C13orf2, KIAA1778, PFET1, BTB/POZ domain-containing protein KCTD12, Pfetin, Predominantly fetal expressed T1 domain) (FITC) discontinued
037356-FITC 200 µL

KCTD12, ID (KCTD12, C13orf2, KIAA1778, PFET1, BTB/POZ domain-containing protein KCTD12, Pfetin, Predominantly fetal expressed T1 domain) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)
MBS1019375-01 0.02 mg (E-Coli)

Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)

Sign In for Pricing
View Details
Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)
MBS1019375-02 0.1 mg (E-Coli)

Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)

Sign In for Pricing
View Details
Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)
MBS1019375-03 0.02 mg (Yeast)

Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)

Sign In for Pricing
View Details
Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)
MBS1019375-04 0.1 mg (Yeast)

Recombinant Passer montanus Hemoglobin subunit alpha-A (HBAA)

Sign In for Pricing
View Details