Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOP1 Rabbit Polyclonal Antibody (HRP)

OTOP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC163302, MGC163304

UniProt

Q7RTM1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTOP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_819056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1D (NM_015194) Human Over-expression Lysate
LH09547V 100 µg

MYO1D (NM_015194) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ecsit ELISA KIT
ELI-47171m 96 Tests

Mouse Ecsit ELISA KIT

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-01 48 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-02 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-03 5x 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-04 10x 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details