Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKD1L1 Rabbit Polyclonal Antibody (HRP)

PKD1L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTX8, PRO19563

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKD1L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSDGKCGCPWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSVVNEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

130kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

EAW61006

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sap30l Mouse Gene Knockout Kit (CRISPR)
KN515293 1 Kit

Sap30l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF810553 100 µg

RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL
BNC941683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details