Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD6 Rabbit Polyclonal Antibody (HRP)

ABHD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BV23

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABHD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8423979-01 0.12 mL

Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8423979-02 0.2 mL

Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8423979-03 5x 0.2 mL

Rabbit Anti Human HEXA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
BOLA3 Protein Vector (Human) (pPB-His-MBP)
PV327306 500 ng

BOLA3 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Micro Tip Box
5021250/2 1 Each

Micro Tip Box

Sign In for Pricing
View Details
ARSG Antibody
orb1326529 100 µg

ARSG Antibody

Sign In for Pricing
View Details