Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR3E Rabbit Polyclonal Antibody (HRP)

HTR3E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5-HT3E, 5-HT3-E, 5-HT3c1

UniProt

E9PGF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HTR3E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL1 (Mitochondrial Ribosomal Protein L1, BM022, FLJ96680, L1MT, MRP-L1) (MaxLight 650)
248879-ML650 100 µL

MRPL1 (Mitochondrial Ribosomal Protein L1, BM022, FLJ96680, L1MT, MRP-L1) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human PEX14 sgRNA gene knockout kit - Lentiviral human PEX14 sgRNA gene knockout kit (plasmid)
GTR15387188 1 Vial

Lentiviral human PEX14 sgRNA gene knockout kit - Lentiviral human PEX14 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HIP1 Peptide - N-terminal region
orb1999245 100 µg

HIP1 Peptide - N-terminal region

Sign In for Pricing
View Details
ENOSF1, NT (ENOSF1, RTS, TYMSAS, Mitochondrial enolase superfamily member 1, Antisense RNA to thymidylate synthase) (AP)
MBS6295622-01 0.2 mL

ENOSF1, NT (ENOSF1, RTS, TYMSAS, Mitochondrial enolase superfamily member 1, Antisense RNA to thymidylate synthase) (AP)

Sign In for Pricing
View Details
ENOSF1, NT (ENOSF1, RTS, TYMSAS, Mitochondrial enolase superfamily member 1, Antisense RNA to thymidylate synthase) (AP)
MBS6295622-02 5x 0.2 mL

ENOSF1, NT (ENOSF1, RTS, TYMSAS, Mitochondrial enolase superfamily member 1, Antisense RNA to thymidylate synthase) (AP)

Sign In for Pricing
View Details
P/P040/NL342/RFL-590X390-1 Prohibited Activity Signs & Labels (Adhesive)
304205 1 Pack (1 Panel (s) x 1 Pack)

P/P040/NL342/RFL-590X390-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details