Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3 Rabbit Polyclonal Antibody (FITC)

KIR2DL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, NKAT2B, CD158B2, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, KIR-023GB

UniProt

P43628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-06906-01 5 µg

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-06906-02 10 µg

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-06906-03 20 µg

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-06906-04 50 µg

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-06906-05 100 µg

OX40/TNFRSF4 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
Rpb1 CTD (Phospho-Thr4) rabbit pAb
MBS9458715-01 0.05 mL

Rpb1 CTD (Phospho-Thr4) rabbit pAb

Sign In for Pricing
View Details