Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF2 Rabbit Polyclonal Antibody (HRP)

NDUFAF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MMTN, B17.2L, MC1DN10, mimitin, NDUFA12L

UniProt

Q8N183

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFAF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_777549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Versican (VS) Antibody Pair Kit (with Standard)
MBS2100918-01 5x 96 Tests

Human Versican (VS) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Versican (VS) Antibody Pair Kit (with Standard)
MBS2100918-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Versican (VS) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Versican (VS) Antibody Pair Kit (with Standard)
MBS2100918-03 10x 96 Tests

Human Versican (VS) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Versican (VS) Antibody Pair Kit (with Standard)
MBS2100918-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Versican (VS) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
BRN4 (POU3F4) Human Over-expression Lysate
orb1362019 20 µg

BRN4 (POU3F4) Human Over-expression Lysate

Sign In for Pricing
View Details
Cpne2 3'UTR Luciferase Stable Cell Line
TU104304 1.0 mL

Cpne2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details