Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF2 Rabbit Polyclonal Antibody (HRP)

NDUFAF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MMTN, B17.2L, MC1DN10, mimitin, NDUFA12L

UniProt

Q8N183

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFAF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_777549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit
MBS7211978-01 48 Well

Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit
MBS7211978-02 96 Well

Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit
MBS7211978-03 5x 96 Well

Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit
MBS7211978-04 10x 96 Well

Guinea pig Core-binding factor subunit beta (CBFB) ELISA Kit

Sign In for Pricing
View Details
MMP3 Rabbit Polyclonal Antibody (Fluoro594)
orb3078197 100 µg

MMP3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
ZNF645 siRNA (Human)
CRJ5865-01 15 nmol

ZNF645 siRNA (Human)

Sign In for Pricing
View Details