Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABGAP1 Rabbit Polyclonal Antibody (HRP)

RABGAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAPCENA, TBC1D11

UniProt

Q9Y3P9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RABGAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL-1 (Segment Polarity Protein Dishevelled Homolog DVL-1, Dishevelled-1, DSH Homolog 1, DVL1) (PE)
MBS6376776-01 0.1 mL

DVL-1 (Segment Polarity Protein Dishevelled Homolog DVL-1, Dishevelled-1, DSH Homolog 1, DVL1) (PE)

Sign In for Pricing
View Details
DVL-1 (Segment Polarity Protein Dishevelled Homolog DVL-1, Dishevelled-1, DSH Homolog 1, DVL1) (PE)
MBS6376776-02 5x 0.1 mL

DVL-1 (Segment Polarity Protein Dishevelled Homolog DVL-1, Dishevelled-1, DSH Homolog 1, DVL1) (PE)

Sign In for Pricing
View Details
EZ Cap™ Cre mRNA (ΨUTP)
R1029-1 1 mg (1 mg/mL)

EZ Cap™ Cre mRNA (ΨUTP)

Sign In for Pricing
View Details
ELF5, ID (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (MaxLight 490)
MBS6473701-01 0.1 mL

ELF5, ID (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (MaxLight 490)

Sign In for Pricing
View Details
ELF5, ID (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (MaxLight 490)
MBS6473701-02 5x 0.1 mL

ELF5, ID (ETS-related Transcription Factor Elf-5, E74-like Factor 5, Epithelium-specific Ets Transcription Factor 2, ESE-2, Epithelium-restricted ESE-1-related Ets Factor, ESE2) (MaxLight 490)

Sign In for Pricing
View Details
Synaptoporin/SYNPR Rabbit Polyclonal Antibody (HRP)
orb2648941 100 µg

Synaptoporin/SYNPR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details