Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC16B Rabbit Polyclonal Antibody (Biotin)

SEC16B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGPR, LZTR2, SEC16S, PGPR-p117, RGPR-p117

UniProt

Q96JE7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC16B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Platelet Derived Growth Factor AB (PDGF-AB) ELISA Kit
orb1807272-01 48 Tests

Human Platelet Derived Growth Factor AB (PDGF-AB) ELISA Kit

Sign In for Pricing
View Details
Human Platelet Derived Growth Factor AB (PDGF-AB) ELISA Kit
orb1807272-02 96 Tests

Human Platelet Derived Growth Factor AB (PDGF-AB) ELISA Kit

Sign In for Pricing
View Details
Galnt11 ORF Vector (Rat) (pORF)
ORF067388 1.0 µg DNA

Galnt11 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ARID1B Rabbit Polyclonal Antibody (BF405)
orb2533640 100 µL

ARID1B Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Anti-EEA1 Antibody (R1C49)
RHH01301 100 μg

Anti-EEA1 Antibody (R1C49)

Sign In for Pricing
View Details
Collagen 8 alpha 1 Blocking Peptide
CBP1257-01 1 mg

Collagen 8 alpha 1 Blocking Peptide

Sign In for Pricing
View Details