Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC16B Rabbit Polyclonal Antibody (HRP)

SEC16B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGPR, LZTR2, SEC16S, PGPR-p117, RGPR-p117

UniProt

Q96JE7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC16B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PALB2 Rabbit Polyclonal Antibody (PE)
orb490961 100 µL

PALB2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Gpr63 3'UTR GFP Stable Cell Line
TU159036 1.0 mL

Gpr63 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rno-miR-147 miRNA Mimic
orb1873966-01 5 nmol

Rno-miR-147 miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-147 miRNA Mimic
orb1873966-02 10 nmol

Rno-miR-147 miRNA Mimic

Sign In for Pricing
View Details
Procion red MX 8B
T87246-01 10 mg

Procion red MX 8B

Sign In for Pricing
View Details
Procion red MX 8B
T87246-02 50 mg

Procion red MX 8B

Sign In for Pricing
View Details