Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG2 Rabbit Polyclonal Antibody (Biotin)

STAG2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SA2, MKMS, SA-2, HPE13, SCC3B, NEDXCF, bA517O1.1

UniProt

Q8N3U4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAG2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS35 Antibody - N-terminal region : FITC (ARP53176_P050-FITC)
ARP53176_P050-FITC 100 µL

PRSS35 Antibody - N-terminal region : FITC (ARP53176_P050-FITC)

Sign In for Pricing
View Details
Pertussis Toxin, L pack
JBS-PR-BA120P-L 1 mg

Pertussis Toxin, L pack

Sign In for Pricing
View Details
EHMT2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61806R-BF594-01 20 µL

EHMT2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
EHMT2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61806R-BF594-02 100 µL

EHMT2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Cattle Matrix Metalloproteinase 2 (MMP2) ELISA Kit
orb2668170-01 48 Tests

Cattle Matrix Metalloproteinase 2 (MMP2) ELISA Kit

Sign In for Pricing
View Details
Cattle Matrix Metalloproteinase 2 (MMP2) ELISA Kit
orb2668170-02 96 Tests

Cattle Matrix Metalloproteinase 2 (MMP2) ELISA Kit

Sign In for Pricing
View Details