Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG2 Rabbit Polyclonal Antibody (HRP)

STAG2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SA2, MKMS, SA-2, HPE13, SCC3B, NEDXCF, bA517O1.1

UniProt

Q8N3U4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAG2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-465a-3p miRNA Agomir
abx882949-01 5 nmol

Mouse mmu-miR-465a-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-465a-3p miRNA Agomir
abx882949-02 10 nmol

Mouse mmu-miR-465a-3p miRNA Agomir

Sign In for Pricing
View Details
C87977 Protein Vector (Mouse) (pPB-N-His)
PV160639 500 ng

C87977 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human C11orf96 (NM_001145033) AAV Particle
RC227406A1V 250 µL

Human C11orf96 (NM_001145033) AAV Particle

Sign In for Pricing
View Details
Dextran 70 - MW 64,000 to 76,000, EP
YD172635-01 0.1 Kg

Dextran 70 - MW 64,000 to 76,000, EP

Sign In for Pricing
View Details
Dextran 70 - MW 64,000 to 76,000, EP
YD172635-02 0.25 kg

Dextran 70 - MW 64,000 to 76,000, EP

Sign In for Pricing
View Details