Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG2 Rabbit Polyclonal Antibody (HRP)

STAG2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SA2, MKMS, SA-2, HPE13, SCC3B, NEDXCF, bA517O1.1

UniProt

Q8N3U4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAG2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)
MBS6452559-01 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)
MBS6452559-02 5x 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)

Sign In for Pricing
View Details
Anti-ROR1 (zilovertamab biosimilar) mAb
12-9132-100 100 µg

Anti-ROR1 (zilovertamab biosimilar) mAb

Sign In for Pricing
View Details
DOCK4 Antibody
MBS9435375-01 0.05 mL

DOCK4 Antibody

Sign In for Pricing
View Details
DOCK4 Antibody
MBS9435375-02 0.1 mL

DOCK4 Antibody

Sign In for Pricing
View Details
DOCK4 Antibody
MBS9435375-03 5x 0.1 mL

DOCK4 Antibody

Sign In for Pricing
View Details