Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSA1 Rabbit Polyclonal Antibody (Biotin)

AHSA1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P38, AHA1, hAha1, C14orf3

UniProt

O95433

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AHSA1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit
MBS9915241-01 48 Well

Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit

Sign In for Pricing
View Details
Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit
MBS9915241-02 96 Well

Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit

Sign In for Pricing
View Details
Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit
MBS9915241-03 5x 96 Well

Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit

Sign In for Pricing
View Details
Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit
MBS9915241-04 10x 96 Well

Canine Tight Junction-Associated Protein 1 (TJAP1) ELISA Kit

Sign In for Pricing
View Details
CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 650)
MBS6467039-01 0.1 mL

CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 650)

Sign In for Pricing
View Details
CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 650)
MBS6467039-02 5x 0.1 mL

CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 650)

Sign In for Pricing
View Details