Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSA1 Rabbit Polyclonal Antibody (HRP)

AHSA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P38, AHA1, hAha1, C14orf3

UniProt

O95433

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AHSA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Resistin (APC) discontinued
R1585-21A-APC 100 µL

Resistin (APC) discontinued

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS616402 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
PLEKHA6 (Pleckstrin Homology Domain Containing, Family A Member 6, KIAA0969, MGC176733, PEPP3) (MaxLight 550)
250211-ML550 100 µL

PLEKHA6 (Pleckstrin Homology Domain Containing, Family A Member 6, KIAA0969, MGC176733, PEPP3) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human GRAMD1C sgRNA gene knockout kit - Lentiviral human GRAMD1C sgRNA gene knockout kit (plasmid)
GTR15360962 1 Vial

Lentiviral human GRAMD1C sgRNA gene knockout kit - Lentiviral human GRAMD1C sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Slu7 Antibody - middle region : Biotin (ARP52180_P050-Biotin)
ARP52180_P050-Biotin 100 µL

Slu7 Antibody - middle region : Biotin (ARP52180_P050-Biotin)

Sign In for Pricing
View Details
ADAMTS16 Recombinant Protein
OPCD01103-200UG 200 µg

ADAMTS16 Recombinant Protein

Sign In for Pricing
View Details