Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSA1 Rabbit Polyclonal Antibody (HRP)

AHSA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P38, AHA1, hAha1, C14orf3

UniProt

O95433

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AHSA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf33 CRISPR Activation Plasmid (h)
sc-414968-ACT 20 µg

C15orf33 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Bovine PAP associated domain containing 4 ELISA Kit
OM618340 96 Strip Well

Bovine PAP associated domain containing 4 ELISA Kit

Sign In for Pricing
View Details
Anti-human CD20 (TRU-015 Biosimilar)
BIO0468SM-5mg 5 mg

Anti-human CD20 (TRU-015 Biosimilar)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACC2 Polyclonal Antibody
MBS7137752 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACC2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD200/OX2 Antibody (325516) [Allophycocyanin/Cy7]
FAB27241APCCY7 0.1 mL

Mouse Monoclonal CD200/OX2 Antibody (325516) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
MAS Human Recombinant Protein, Synthetic Nanodisc
TP721709 10 µg

MAS Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details