Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin Z/CTSZ, Human (HEK293, His)

Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin Z/CTSZ Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-z-ctsz-protein-human-hek293-c-his.html

Purity

95.0

Smiles

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVHHHHHH

Molecular Formula

1522 (Gene_ID) Q9UBR2 (G24-V303) (Accession)

Molecular Weight

37-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS623447 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
KLF2 (N-term) Goat Polyclonal Antibody
AP32695PU-N 100 µg

KLF2 (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), 0.2mg/mL
BNUB2751-100 1x 100 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), 0.2mg/mL

Sign In for Pricing
View Details
NT5DC1 (NM_152729) Human Recombinant Protein
TP311087M 100 µg

NT5DC1 (NM_152729) Human Recombinant Protein

Sign In for Pricing
View Details
CLPSL2 (NM_207409) Human Over-expression Lysate
LC404015 20 µg

CLPSL2 (NM_207409) Human Over-expression Lysate

Sign In for Pricing
View Details
CD1B (NM_001764) Human Over-expression Lysate
LC419761 20 µg

CD1B (NM_001764) Human Over-expression Lysate

Sign In for Pricing
View Details