Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MREG Rabbit Polyclonal Antibody (Biotin)

MREG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DSU, WDT2

UniProt

Q8N565

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MREG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060470

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HtrA2/Omi (S306A) Recombinant Protein
PROTO43464-500ug 500 µg

Human HtrA2/Omi (S306A) Recombinant Protein

Sign In for Pricing
View Details
Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit
MBS2904904-01 48 Well

Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit

Sign In for Pricing
View Details
Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit
MBS2904904-02 96 Well

Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit

Sign In for Pricing
View Details
Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit
MBS2904904-03 5x 96 Well

Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit

Sign In for Pricing
View Details
Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit
MBS2904904-04 10x 96 Well

Bovine NLRP9/NACHT, LRR and PYD domains-containing protein 9 ELISA Kit

Sign In for Pricing
View Details
NR2F6, NT (NR2F6, EAR2, ERBAL2, Nuclear receptor subfamily 2 group F member 6, V-erbA-related protein 2) (MaxLight 550)
MBS6326618-01 0.1 mL

NR2F6, NT (NR2F6, EAR2, ERBAL2, Nuclear receptor subfamily 2 group F member 6, V-erbA-related protein 2) (MaxLight 550)

Sign In for Pricing
View Details