Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT7 Rabbit Polyclonal Antibody (HRP)

NUDT7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0C024

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001099133

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC (SHC1) pTyr427 Rabbit Polyclonal Antibody
AP02542PU-S 50 µL

SHC (SHC1) pTyr427 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF740 conjugate, 0.1mg/mL
BNC742076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mitochondrial Marker (113-1), CF594 conjugate, 0.1mg/mL
BNC940739-500 1x 500 µL

Mitochondrial Marker (113-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPTE2 Human Gene Knockout Kit (CRISPR)
KN211861LP 1 Kit

TPTE2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRP94 Antibody
SPC-101S 12 µg

GRP94 Antibody

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF594 conjugate, 0.1mg/mL
BNC942837-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details