Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL1 Rabbit Polyclonal Antibody (HRP)

PPIL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYPL1, hCyPX, PPIase, CGI-124

UniProt

Q9Y3C6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPIL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human GPNMB Antibody (SAA0149), PE
FHG93112 100 Tests

Anti-Human GPNMB Antibody (SAA0149), PE

Sign In for Pricing
View Details
Recombinant Danio rerio Malectin (mlec)
orb2902781-01 20 µg

Recombinant Danio rerio Malectin (mlec)

Sign In for Pricing
View Details
Recombinant Danio rerio Malectin (mlec)
orb2902781-02 100 µg

Recombinant Danio rerio Malectin (mlec)

Sign In for Pricing
View Details
Lentiviral mouse 2610528J11Rik shRNA (UAS) - Lentiviral mouse 2610528J11Rik shRNA (UAS) plasmid
GTR15168535 1 Vial

Lentiviral mouse 2610528J11Rik shRNA (UAS) - Lentiviral mouse 2610528J11Rik shRNA (UAS) plasmid

Sign In for Pricing
View Details
3110062M04Rik Recombinant Protein (Mouse)
RP111530 100 µg

3110062M04Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-CD150/SLAM (Rabbit, Monoclonal)
A102428 100 µL

Anti-CD150/SLAM (Rabbit, Monoclonal)

Sign In for Pricing
View Details