Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36A Rabbit Polyclonal Antibody (HRP)

RPL36A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L36A, L44L, MIG6, RPL44

UniProt

P83881

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RPL36A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_066357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) (APC)
MBS6449991-01 0.1 mL

TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) (APC)

Sign In for Pricing
View Details
TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) (APC)
MBS6449991-02 5x 0.1 mL

TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) (APC)

Sign In for Pricing
View Details
PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21(CDKN1A)-activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7) (MaxLight 490)
MBS6491862-01 0.1 mL

PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21(CDKN1A)-activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7) (MaxLight 490)

Sign In for Pricing
View Details
PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21(CDKN1A)-activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7) (MaxLight 490)
MBS6491862-02 5x 0.1 mL

PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21(CDKN1A)-activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7) (MaxLight 490)

Sign In for Pricing
View Details
Dnahc11 ORF Vector (Mouse) (pORF)
ORF043136 1.0 µg DNA

Dnahc11 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CAPN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV807081 1.0 µg DNA

CAPN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details