Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP2 Rabbit Polyclonal Antibody (Biotin)

RPLP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P2, LP2, RPP2, D11S2243E

UniProt

P05387

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPLP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S1P (Sphingosine 1 phosphate) ELISA Kit
MBS2516132-01 24 Tests

Human S1P (Sphingosine 1 phosphate) ELISA Kit

Sign In for Pricing
View Details
Human S1P (Sphingosine 1 phosphate) ELISA Kit
MBS2516132-02 48 Tests

Human S1P (Sphingosine 1 phosphate) ELISA Kit

Sign In for Pricing
View Details
Human S1P (Sphingosine 1 phosphate) ELISA Kit
MBS2516132-03 96 Tests

Human S1P (Sphingosine 1 phosphate) ELISA Kit

Sign In for Pricing
View Details
Human S1P (Sphingosine 1 phosphate) ELISA Kit
MBS2516132-04 5x 96 Tests

Human S1P (Sphingosine 1 phosphate) ELISA Kit

Sign In for Pricing
View Details
Human S1P (Sphingosine 1 phosphate) ELISA Kit
MBS2516132-05 10x 96 Tests

Human S1P (Sphingosine 1 phosphate) ELISA Kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe BSD domain-containing protein C22A12.14c (SPAC22A12.14c)
MBS1112286-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe BSD domain-containing protein C22A12.14c (SPAC22A12.14c)

Sign In for Pricing
View Details