Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER2 Rabbit Polyclonal Antibody (Biotin)

ACER2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ASAH3L, ALKCDase2

UniProt

Q5QJU3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ACER2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamic Pyruvic Transaminase (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (HRP)
MBS6400706-01 0.1 mL

Glutamic Pyruvic Transaminase (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (HRP)

Sign In for Pricing
View Details
Glutamic Pyruvic Transaminase (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (HRP)
MBS6400706-02 5x 0.1 mL

Glutamic Pyruvic Transaminase (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (HRP)

Sign In for Pricing
View Details
Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit
MBS9342522-01 48 Well

Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit
MBS9342522-02 96 Well

Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit
MBS9342522-03 5x 96 Well

Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit
MBS9342522-04 10x 96 Well

Mouse Transmembrane 4 L6 family member 1, TM4SF1 ELISA Kit

Sign In for Pricing
View Details