Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMKN Rabbit Polyclonal Antibody (Biotin)

DMKN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UNQ729, ZD52F10

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DMKN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001177276

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtf2 Mouse siRNA Oligo Duplex (Locus ID 17765)
SR417916 1 Kit

Mtf2 Mouse siRNA Oligo Duplex (Locus ID 17765)

Sign In for Pricing
View Details
NME1/NM23A Recombinant Antibody, APC Conjugated
bsm-62920R-APC-01 20 µL

NME1/NM23A Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
NME1/NM23A Recombinant Antibody, APC Conjugated
bsm-62920R-APC-02 100 µL

NME1/NM23A Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
NFAT1 (Phospho Ser326) rabbit pAb Antibody
orb2307562-01 50 µL

NFAT1 (Phospho Ser326) rabbit pAb Antibody

Sign In for Pricing
View Details
NFAT1 (Phospho Ser326) rabbit pAb Antibody
orb2307562-02 100 µL

NFAT1 (Phospho Ser326) rabbit pAb Antibody

Sign In for Pricing
View Details
Recombinant Chicken Protein LLP homolog (LLPH)
MBS1306457-01 0.02 mg (E-Coli)

Recombinant Chicken Protein LLP homolog (LLPH)

Sign In for Pricing
View Details