Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMKN Rabbit Polyclonal Antibody (HRP)

DMKN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UNQ729, ZD52F10

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DMKN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001177276

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMOD1 (Lleiomodin 1, 1D, D1, 64kD, SM-LMOD) (MaxLight 750)
MBS6424888-01 0.1 mL

LMOD1 (Lleiomodin 1, 1D, D1, 64kD, SM-LMOD) (MaxLight 750)

Sign In for Pricing
View Details
LMOD1 (Lleiomodin 1, 1D, D1, 64kD, SM-LMOD) (MaxLight 750)
MBS6424888-02 5x 0.1 mL

LMOD1 (Lleiomodin 1, 1D, D1, 64kD, SM-LMOD) (MaxLight 750)

Sign In for Pricing
View Details
BMP-8B shRNA (h) Lentiviral Particles
sc-39750-V 200 µL

BMP-8B shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Geminin (His-tag) Human Protein
AR09030PU-L 500 µg

Geminin (His-tag) Human Protein

Sign In for Pricing
View Details
PROP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
37739066 1.0 µg DNA

PROP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Alpaca Anti-Mouse IgG (H+L) HRP Single Domain Antibody
B2023735 100 µg

Alpaca Anti-Mouse IgG (H+L) HRP Single Domain Antibody

Sign In for Pricing
View Details