Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR160 Rabbit Polyclonal Antibody (Biotin)

GPR160 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GPCR1, GPCR150

UniProt

Q9UJ42

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR160

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISIILYFRDFVLLSIRF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_055188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp316 shRNA (UAS) - Lentiviral mouse Zfp316 shRNA (UAS, GFP) plasmid
GTR15264778 1 Vial

Lentiviral mouse Zfp316 shRNA (UAS) - Lentiviral mouse Zfp316 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SB-277011 dihydrochloride 5mg
A21353-5 5 mg

SB-277011 dihydrochloride 5mg

Sign In for Pricing
View Details
Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit
MBS7207644-01 48 Well

Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit
MBS7207644-02 96 Well

Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit
MBS7207644-03 5x 96 Well

Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit
MBS7207644-04 10x 96 Well

Rabbit Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) ELISA Kit

Sign In for Pricing
View Details