Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPN Rabbit Polyclonal Antibody (HRP)

LIPN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LI4, ARCI8, LIPL4, bA186O14.3

UniProt

Q5VXI9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001095939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GREMLIN, CT (Grem1, Cktsf1b1, Drm, Gremlin-1, Cysteine knot superfamily 1, BMP antagonist 1, Down-regulated in Mos-transformed cells protein) (MaxLight 550)
MBS6304301-01 0.1 mL

GREMLIN, CT (Grem1, Cktsf1b1, Drm, Gremlin-1, Cysteine knot superfamily 1, BMP antagonist 1, Down-regulated in Mos-transformed cells protein) (MaxLight 550)

Sign In for Pricing
View Details
GREMLIN, CT (Grem1, Cktsf1b1, Drm, Gremlin-1, Cysteine knot superfamily 1, BMP antagonist 1, Down-regulated in Mos-transformed cells protein) (MaxLight 550)
MBS6304301-02 5x 0.1 mL

GREMLIN, CT (Grem1, Cktsf1b1, Drm, Gremlin-1, Cysteine knot superfamily 1, BMP antagonist 1, Down-regulated in Mos-transformed cells protein) (MaxLight 550)

Sign In for Pricing
View Details
Sheep Cystatin-B (CSTB) ELISA Kit
MBS284956-01 48 Tests

Sheep Cystatin-B (CSTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Cystatin-B (CSTB) ELISA Kit
MBS284956-02 96 Tests

Sheep Cystatin-B (CSTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Cystatin-B (CSTB) ELISA Kit
MBS284956-03 5x 96 Tests

Sheep Cystatin-B (CSTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Cystatin-B (CSTB) ELISA Kit
MBS284956-04 10x 96 Tests

Sheep Cystatin-B (CSTB) ELISA Kit

Sign In for Pricing
View Details