Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3 Rabbit Polyclonal Antibody (FITC)

RCN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RLP49

UniProt

Q96D15

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RCN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERV (ERVWE1) Antibody Blocking peptide
orb1450752 500 µg

HERV (ERVWE1) Antibody Blocking peptide

Sign In for Pricing
View Details
Human Transforming Growth factor β1, TGF-β1 ELISA kit
orb2656069-01 24 Tests

Human Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Human Transforming Growth factor β1, TGF-β1 ELISA kit
orb2656069-02 48 Tests

Human Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Human Transforming Growth factor β1, TGF-β1 ELISA kit
orb2656069-03 96 Tests

Human Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Human Transforming Growth factor β1, TGF-β1 ELISA kit
orb2656069-04 5 x 96 T

Human Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Human Transforming Growth factor β1, TGF-β1 ELISA kit
orb2656069-05 10 x 96 T

Human Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details