Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT9 Rabbit Polyclonal Antibody (Biotin)

CNOT9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RCD1, CAF40, CT129, RCD-1, RQCD1

UniProt

Q92600

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RQCD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ly6h shRNA (UAS) - Lentiviral mouse Ly6h shRNA (UAS, RFP) (25)
GTR15272783 1 Vial

Lentiviral mouse Ly6h shRNA (UAS) - Lentiviral mouse Ly6h shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PSME2 Goat Polyclonal Antibody
TA303227 100 µg

PSME2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bcr (Breakpoint Cluster Region) discontinued
B0808-30 100 µg

Bcr (Breakpoint Cluster Region) discontinued

Sign In for Pricing
View Details
Canine Glucagon Like Peptide 1 ELISA Kit
MBS020031-01 48 Well

Canine Glucagon Like Peptide 1 ELISA Kit

Sign In for Pricing
View Details
Canine Glucagon Like Peptide 1 ELISA Kit
MBS020031-02 96 Well

Canine Glucagon Like Peptide 1 ELISA Kit

Sign In for Pricing
View Details
Canine Glucagon Like Peptide 1 ELISA Kit
MBS020031-03 5x 96 Well

Canine Glucagon Like Peptide 1 ELISA Kit

Sign In for Pricing
View Details