Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD4 Rabbit Polyclonal Antibody (HRP)

TMOD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SK-TMOD

UniProt

Q9NZQ9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMOD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQYLEQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ACAT2 Antibody (OTI3E2) [mFluor Violet 450 SE]
NBP2-70068MFV450 0.1 mL

Mouse Monoclonal ACAT2 Antibody (OTI3E2) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TrkA (NTRK1, MTC, TRK, TRKA, High affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, TRK1-transforming tyrosine kinase protein, Tropomyosin-related kinase A, Tyrosine kinase receptor, Tyrosine kinase receptor A, gp140trk, p140-TrkA) (PE) discontinued
043273-PE 200 µL

TrkA (NTRK1, MTC, TRK, TRKA, High affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, TRK1-transforming tyrosine kinase protein, Tropomyosin-related kinase A, Tyrosine kinase receptor, Tyrosine kinase receptor A, gp140trk, p140-TrkA) (PE) discontinued

Sign In for Pricing
View Details
DIXDC1 Protein Lysate (Mouse) with C-HA Tag
18255034 100 µg

DIXDC1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human SLC2A5 Recombinant Protein (N-GST & C-His)
HB050022-01 50 µg

Human SLC2A5 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Human SLC2A5 Recombinant Protein (N-GST & C-His)
HB050022-02 100 µg

Human SLC2A5 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Human SLC2A5 Recombinant Protein (N-GST & C-His)
HB050022-03 1 mg

Human SLC2A5 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details