Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap1s1 Rabbit Polyclonal Antibody (Biotin)

Ap1s1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP, AP19

UniProt

P61967

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ap1s1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031483

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB3, NT (ASB3, Ankyrin repeat and SOCS box protein 3) (MaxLight 405)
MBS6275550-01 0.1 mL

ASB3, NT (ASB3, Ankyrin repeat and SOCS box protein 3) (MaxLight 405)

Sign In for Pricing
View Details
ASB3, NT (ASB3, Ankyrin repeat and SOCS box protein 3) (MaxLight 405)
MBS6275550-02 5x 0.1 mL

ASB3, NT (ASB3, Ankyrin repeat and SOCS box protein 3) (MaxLight 405)

Sign In for Pricing
View Details
c-Fos Antibody (PE/ATTO 594)
abx448746 100 µg

c-Fos Antibody (PE/ATTO 594)

Sign In for Pricing
View Details
Anti-CCR2 Antibody Picoband® (monoclonal, 8C4), Cy3 Conjugate
M00158-1-Cy3 100 µg/Vial

Anti-CCR2 Antibody Picoband® (monoclonal, 8C4), Cy3 Conjugate

Sign In for Pricing
View Details
ATP6V1C2 (V-type Proton ATPase Subunit C 2, V-ATPase Subunit C 2, Vacuolar Proton Pump Subunit C 2) (Biotin)
123730-Biotin 100 µL

ATP6V1C2 (V-type Proton ATPase Subunit C 2, V-ATPase Subunit C 2, Vacuolar Proton Pump Subunit C 2) (Biotin)

Sign In for Pricing
View Details
Nck beta Polyclonal Antibody, PE-Cy5 Conjugated
bs-4280R-PE-Cy5 100 µL

Nck beta Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details