Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP22 Rabbit Polyclonal Antibody (HRP)

ARHGAP22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RhoGAP2, RhoGap22

UniProt

Q7Z5H3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARHGAP22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_067049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alg2 (NM_019998) Mouse Tagged Lenti ORF Clone
MR206559L3 10 µg

Alg2 (NM_019998) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human Homeobox protein TGIF2LX Protein, His-SUMO, E.coli-100ug
QP7806-ec-100ug 100ug

Recombinant Human Homeobox protein TGIF2LX Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
Bovine Integrin beta-5, ITGB5 ELISA Kit
MBS1605263-01 48 Well

Bovine Integrin beta-5, ITGB5 ELISA Kit

Sign In for Pricing
View Details
Bovine Integrin beta-5, ITGB5 ELISA Kit
MBS1605263-02 96 Well

Bovine Integrin beta-5, ITGB5 ELISA Kit

Sign In for Pricing
View Details
Bovine Integrin beta-5, ITGB5 ELISA Kit
MBS1605263-03 5x 96 Well

Bovine Integrin beta-5, ITGB5 ELISA Kit

Sign In for Pricing
View Details
Bovine Integrin beta-5, ITGB5 ELISA Kit
MBS1605263-04 10x 96 Well

Bovine Integrin beta-5, ITGB5 ELISA Kit

Sign In for Pricing
View Details