Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESF1 Rabbit Polyclonal Antibody (HRP)

ESF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABTAP, C20orf6, HDCMC28P, bA526K24.1

UniProt

Q9H501

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ESF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTEQFQARKKQKVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PALLD ELISA Kit (Human) (OKCD00284)
OKCD00284 96 Well

PALLD ELISA Kit (Human) (OKCD00284)

Sign In for Pricing
View Details
Olr855 Protein Lysate (Rat) with C-HA Tag
34742036 100 µg

Olr855 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Phospho-CEBP alpha (Thr222 + Thr226) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-3061R-BF594 100 µL

Phospho-CEBP alpha (Thr222 + Thr226) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RAI14 (NM_001145520) Human Recombinant Protein
TP327548 20 µg

RAI14 (NM_001145520) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Rhamnulokinase (rhaB)
MBS1108122-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Rhamnulokinase (rhaB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Rhamnulokinase (rhaB)
MBS1108122-02 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Rhamnulokinase (rhaB)

Sign In for Pricing
View Details