Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLVCR2 Rabbit Polyclonal Antibody (Biotin)

FLVCR2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCT, EPV, PVHH, MFSD7C, SLC49A2, C14orf58, FLVCRL14q

UniProt

Q9UPI3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLVCR2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001182212

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Itga7 shRNA (UAS) - Lentiviral mouse Itga7 shRNA (UAS, RFP) (25)
GTR15303674 1 Vial

Lentiviral mouse Itga7 shRNA (UAS) - Lentiviral mouse Itga7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Monoclonal Mrc2 Antibody (Quark patent anti-ENDO 180) [Janelia Fluor 585]
NBP3-28883JF585 0.1 mL

Human Monoclonal Mrc2 Antibody (Quark patent anti-ENDO 180) [Janelia Fluor 585]

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Mouse Monoclonal Antibody [Clone:2G3]
E45M21391 100 µg

Myeloperoxidase (MPO) Mouse Monoclonal Antibody [Clone:2G3]

Sign In for Pricing
View Details
LOC100503404 3'UTR Luciferase Stable Cell Line
TU111796 1.0 mL

LOC100503404 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TMEFF1, CT (Tomoregulin-1,TMEFF1,C9orf2) (MaxLight 650)
MBS6356303-01 0.1 mL

TMEFF1, CT (Tomoregulin-1,TMEFF1,C9orf2) (MaxLight 650)

Sign In for Pricing
View Details
TMEFF1, CT (Tomoregulin-1,TMEFF1,C9orf2) (MaxLight 650)
MBS6356303-02 5x 0.1 mL

TMEFF1, CT (Tomoregulin-1,TMEFF1,C9orf2) (MaxLight 650)

Sign In for Pricing
View Details