Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLVCR2 Rabbit Polyclonal Antibody (FITC)

FLVCR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCT, EPV, PVHH, MFSD7C, SLC49A2, C14orf58, FLVCRL14q

UniProt

Q9UPI3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLVCR2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dematin (DMTN) (NM_001114135) Human Over-expression Lysate
LY426463 100 µg

Dematin (DMTN) (NM_001114135) Human Over-expression Lysate

Sign In for Pricing
View Details
UNC5C (NM_003728) Human Recombinant Protein
TP324257 20 µg

UNC5C (NM_003728) Human Recombinant Protein

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF488A conjugate, 0.1mg/mL
BNC881486-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cry1 activation kit by CRISPRa
GA200892 1 Kit

Mouse Cry1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Ctss activation kit by CRISPRa
GA200954 1 Kit

Mouse Ctss activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Unknown tissue consistent with neuroendocrine origin
CS715022 5x 5 µm

Tissue FFPE Sections, Unknown tissue consistent with neuroendocrine origin

Sign In for Pricing
View Details