Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLVCR2 Rabbit Polyclonal Antibody (HRP)

FLVCR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCT, EPV, PVHH, MFSD7C, SLC49A2, C14orf58, FLVCRL14q

UniProt

Q9UPI3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLVCR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [mFluor Violet 500 SE]
NBP3-27986MFV500 0.1 mL

Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Anti-human Fibrinogen, Matched Pair Antibodies for EIA
5D-18132 5 Plates

Anti-human Fibrinogen, Matched Pair Antibodies for EIA

Sign In for Pricing
View Details
Cyclin H Rabbit Polyclonal Antibody
E28PT1182 100 µL

Cyclin H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Xylene mixed isomers, GlenPure™, analytical grade
GS4352-500ml 500 mL

Xylene mixed isomers, GlenPure™, analytical grade

Sign In for Pricing
View Details
Rab 2A Polyclonal Antibody
ABP55964-01 30 µL

Rab 2A Polyclonal Antibody

Sign In for Pricing
View Details
Rab 2A Polyclonal Antibody
ABP55964-02 100 µL

Rab 2A Polyclonal Antibody

Sign In for Pricing
View Details