Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGNBP1 Rabbit Polyclonal Antibody (Biotin)

GGNBP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GGNBP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VALQSPPNKAFRSTDTVGFLESELKKLLGMQQESRLWKLGSQEGRELLTR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

AAR26430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX2 (Homeobox Protein DLX-2) discontinued
D3800-04E 50 µg

DLX2 (Homeobox Protein DLX-2) discontinued

Sign In for Pricing
View Details
GLUT 1 (Glucose Transporter 1) (MaxLight 490)
G3900-12-ML490 100 µL

GLUT 1 (Glucose Transporter 1) (MaxLight 490)

Sign In for Pricing
View Details
FRA1J sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0801408 1.0 µg DNA

FRA1J sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-CD158a/KIR2DL1 (Rabbit, Monoclonal)
A107570 100 µL

Anti-CD158a/KIR2DL1 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Phospho-PDPK1 (Tyr9) Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1975234 100 µL

Phospho-PDPK1 (Tyr9) Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus MAB_3886c Protein (aa 1-314)
VAng-Yyj5471-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Abscessus MAB_3886c Protein (aa 1-314)

Sign In for Pricing
View Details