Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGNBP1 Rabbit Polyclonal Antibody (HRP)

GGNBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GGNBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALQSPPNKAFRSTDTVGFLESELKKLLGMQQESRLWKLGSQEGRELLTR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

AAR26430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EV71 3C Rabbit pAb
A20687-01 1000 μL

EV71 3C Rabbit pAb

Sign In for Pricing
View Details
EV71 3C Rabbit pAb
A20687-02 20 µL

EV71 3C Rabbit pAb

Sign In for Pricing
View Details
EV71 3C Rabbit pAb
A20687-03 100 μL

EV71 3C Rabbit pAb

Sign In for Pricing
View Details
EV71 3C Rabbit pAb
A20687-04 500 μL

EV71 3C Rabbit pAb

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Aspartate--tRNA ligase (aspS)
MBS1051273-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O8 Aspartate--tRNA ligase (aspS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Aspartate--tRNA ligase (aspS)
MBS1051273-02 0.02 mg (Yeast)

Recombinant Escherichia coli O8 Aspartate--tRNA ligase (aspS)

Sign In for Pricing
View Details